| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300025184 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0054353 | Ga0208832 |
| Sample Name | Marine microbial communities from the Deep Pacific Ocean - MP2158 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 43306442 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2 |
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Southwest of Acapulco, Mexico, North Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 12.0 | Long. (o) | -108.06 | Alt. (m) | N/A | Depth (m) | 3103.11 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010197 | Metagenome | 307 | Y |
| F031535 | Metagenome | 182 | N |
| F065862 | Metagenome | 127 | Y |
| F066126 | Metagenome | 127 | Y |
| F101336 | Metagenome / Metatranscriptome | 102 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0208832_101024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 4456 | Open in IMG/M |
| Ga0208832_101029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 4435 | Open in IMG/M |
| Ga0208832_106919 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 884 | Open in IMG/M |
| Ga0208832_108649 | Not Available | 767 | Open in IMG/M |
| Ga0208832_115863 | Not Available | 525 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0208832_101024 | Ga0208832_1010246 | F101336 | SFIPTKIALVGESSLTSVDTFVSKGTAKTSFYGNSWQATY |
| Ga0208832_101029 | Ga0208832_1010294 | F010197 | LLPNTTHKLKAFTIKHDFAQHMQKVFSRQDGILFSFEEV |
| Ga0208832_106919 | Ga0208832_1069193 | F031535 | IIDSIDKPSPKATTDNIIARGPKNTRAYVAIASANQLRGLTNEVNHFQVPFKTFEFYTVNIE |
| Ga0208832_108649 | Ga0208832_1086491 | F065862 | TDSERFTGAVFETESVNNTVSDRFTPAAFEIESVKLTVSDRFTAAAFEIESVNNTVSDRFTPAAFEIESVNNTVSDRFTPAAFEIESVNNTVSDRFTPAVFEIESVNDTDSERFTGAVFETESVKLTDSDKFTPAVFETESVNDIDSVRFTPAVFEIESVNNTVSDRFTPAVFEIESVNDTDSDRFTGAVFEIESVKLTVSDRFTPAVFEIESVKLTVSDRFTPAAFEIESVKLTVSDRFTPAAFEIESVKLTVS |
| Ga0208832_115863 | Ga0208832_1158632 | F066126 | KNFPKNKANLGGINSVGIAIKNTKTIPIYKKRLNNNDLISNI |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |