NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300025081

3300025081: Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection B2 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300025081 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0053054 | Gp0056925 | Ga0208953
Sample NameGroundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection B2 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size280875036
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Archaea → DPANN group1
Not Available3
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Rifle, Colorado, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Soil Microbial Communities From Rifle, Colorado, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biome → planetary subsurface zone → groundwater
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationUSA: Rifle, Colorado
CoordinatesLat. (o)39.53Long. (o)-107.78Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053932Metagenome / Metatranscriptome140Y
F056711Metagenome / Metatranscriptome137Y
F065251Metagenome / Metatranscriptome128Y
F073159Metagenome / Metatranscriptome120Y
F082351Metagenome113Y
F085179Metagenome / Metatranscriptome111Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0208953_1001072All Organisms → cellular organisms → Bacteria18292Open in IMG/M
Ga0208953_1035705All Organisms → cellular organisms → Archaea → DPANN group1241Open in IMG/M
Ga0208953_1056583Not Available920Open in IMG/M
Ga0208953_1060788Not Available877Open in IMG/M
Ga0208953_1105367All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria605Open in IMG/M
Ga0208953_1115238Not Available569Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208953_1001072Ga0208953_100107221F073159MCNICGRNCGKGGALRTHIEGAHKVSYDAYKTCFYGDVKTQIADTWDDSVKTHGGQTVITHVLVRRFIGNPGERGVRRKVP
Ga0208953_1035705Ga0208953_10357051F065251MYLRFFKKGRKKYYYIAKAVRKGVRVIQKSILYVGTADTLYEKLVKLKKRA
Ga0208953_1056583Ga0208953_10565832F085179AGLVDSSVLCIGEDGHLAIESAASCAFCASRVLLPVPPESLIPEGSTASGCGPCQDFSIASGREFPGIALPSPPGSVRSDFSLPSMEPAEGSRTMIAFASSVSGPLELPDPIALHARTVVLLI
Ga0208953_1060788Ga0208953_10607881F056711MRKAFTALAAAAFALSIVAGGCAKDKSPSQLQAGKKGIAGTEKKAAPKPRAKLFTGTIEDLDEAAGTLTLKGPKGEMSFQARKKVKEQLGELEIGDKVIVKHDGKTALSIVKPRTSKTALAWYRNEETETVREEFH
Ga0208953_1105367Ga0208953_11053671F053932MNRWLPYVLHPRPGWFILHAAAIVLVFLLGYSVRF
Ga0208953_1115238Ga0208953_11152381F082351TKDHALLLKKEREANNYIKVRTTADPIIKLREDFYDLANEFGFDVPIDFNYISPLKIDWSLKTGTFIREGCIGVALGDIGYIFFKPQILKIYKL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.