NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300022919

3300022919: Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L119-311C-1



Overview

Basic Information
IMG/M Taxon OID3300022919 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0095510 | Gp0290980 | Ga0247810
Sample NamePlant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L119-311C-1
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size726923592
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood21
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → agricultural field → plant litter
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Wisconsin
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013427Metagenome / Metatranscriptome271Y
F023181Metagenome / Metatranscriptome211Y
F034190Metagenome / Metatranscriptome175Y
F041209Metagenome / Metatranscriptome160Y
F051903Metagenome / Metatranscriptome143Y
F057967Metagenome / Metatranscriptome135Y
F065285Metagenome127Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0247810_10052162All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood21632Open in IMG/M
Ga0247810_10133978All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria921Open in IMG/M
Ga0247810_10139038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria901Open in IMG/M
Ga0247810_10153391All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium848Open in IMG/M
Ga0247810_10158113Not Available833Open in IMG/M
Ga0247810_10169295All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria799Open in IMG/M
Ga0247810_10189192Not Available746Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0247810_10052162Ga0247810_100521622F041209MCVAFVRLTHVRAVSAETCEQIAELRRKLQRSRTTHVLFLDETGERLSECPTGTLVLPGEQQYVEATETSSYSKRYDMIACTAGDRVLLPKIFSPKERKDAGVKGINGPMLLQFIDDALAQAVEGLDRYPLTLVLDRASIHLNVDAILQAFHDRGSQSIKDILLMPPNAAKRLSPLDNALFHDWRQEVRKHCPVTARTVTRVMNDAWMKMKPQAHYKHCGLTRLKDPYFDCPAPHEHRHG
Ga0247810_10133978Ga0247810_101339781F051903CACLFSVSAEMCEEIATVRRKFQRIGTRRILVLDETHRRIGDVTERTIVLPGEPSTIETSATTHYAPRYDMIACCTSKEVMPPMIYAPKERGKGIDTEMLLQYIRNLLAQSAGALDRYPLFLMLDKSTIHNEGKIIETFHDWGCQELVEVIKMPTAAAKRLSPLDNSLFNVWRQRALNGPPLTRTNIKQRMSDAWNSITERDLLPQYRHCGLMRRQDVYFDCPNPAAHQHGS
Ga0247810_10139038Ga0247810_101390382F057967VNRDAKTQSALIALARTRRMQRAHAHAYLHRNAPMPTLRASLGYMTGTACISDESTTTAHRMSLLGVARLEGVAYVVEELGAGESPIVYRLFLRGPRQGYLVPMHAWYEHDDDEVIVRAKIAQLAPRLEPLARTTSEAWMLSTRIVHRRALRVSGMELPIRAFALQLAVEPVSGHGSSGKTTVTAFLRPSAQLADVWAVPGTDAAIARISYTGIPSG
Ga0247810_10153391Ga0247810_101533911F013427VIDLSGTCDLAVWCKLLRDKGWSGPRIAREIAKSEGYVNNLIRVVDRASPNVMLRWKLEQDAPDCACHVCATDWLVQICLLPHDVQDAELAQRLTTY
Ga0247810_10158113Ga0247810_101581131F034190QPLLTIPPERIVPTPLHLFLGISNRIILDAFSELLGKERVEAALKSITTFHSAGCGGAADLHDLNGPEISKWIKKECSATLLSAATAASAVTAATSASHSVLSRWLQQLHHCLLRSGDWSAADIDAWRTVVSDIHQHWCAETSQKAFPKLHMLHHSIDFAERHRFLGRASEAQIESCHAFFNSLVHKQHRNQSGNTAERLRRCLADASLRAVQPLLKP
Ga0247810_10169295Ga0247810_101692951F023181AYHLHPRGVVVSLLQLVQLFPRHLRVVELVTEIQGTFLVTSNTHGVDRLEPPPEAKIERLPLHATLTEVLERHTTRITELLRTYPNRQPVTYERIEDVIASVARAHVVMARHRQKVGGISRDELERLKGRPLNPTEEAFLREVQGPQPE
Ga0247810_10189192Ga0247810_101891921F065285RDLDHSSTEIWWDEPFALVPIVHPQQWDPDGPELIQINPLESAVHPLLASILAPRIPQIHLETALSCLRYLQSGGHSVKSRKSLKPLLKSRYFTGLKMRPSLSRFRNRRHRHLSRRCLLDEQDFHSTWWGDHRRRPYDFIYGKSGVLVPLCFFSYRTECASNHDLWYTYRYALLILPFVLVNAPPDSHLASIATNCTFSTFCTAYPRETRKAKKYITQYLSRCRPIRAIRERVVVDVMSGMNVD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.