NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300022353

3300022353: Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R8.37A (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300022353 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114516 | Gp0225675 | Ga0210292
Sample NameMetatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R8.37A (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size22459622
Sequencing Scaffolds8
Novel Protein Genes8
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta1
All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae1
Not Available1
All Organisms → cellular organisms → Eukaryota → Sar2
All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Teleaulax → Teleaulax amphioxeia1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEstuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Alternative Ecosystem Assignments
Environment Ontology (ENVO)estuarine biome → estuary → estuarine water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationUSA: Oregon
CoordinatesLat. (o)46.232Long. (o)-123.889Alt. (m)N/ADepth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011303Metagenome / Metatranscriptome292N
F019482Metagenome / Metatranscriptome229Y
F021307Metagenome / Metatranscriptome219Y
F026746Metagenome / Metatranscriptome197Y
F033054Metagenome / Metatranscriptome178N
F041807Metagenome / Metatranscriptome159N
F067774Metagenome / Metatranscriptome125N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0210292_105447All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta908Open in IMG/M
Ga0210292_106527All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae828Open in IMG/M
Ga0210292_107844Not Available752Open in IMG/M
Ga0210292_111741All Organisms → cellular organisms → Eukaryota → Sar594Open in IMG/M
Ga0210292_112581All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Teleaulax → Teleaulax amphioxeia569Open in IMG/M
Ga0210292_113362All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta549Open in IMG/M
Ga0210292_113862All Organisms → cellular organisms → Eukaryota → Sar536Open in IMG/M
Ga0210292_114353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0210292_105447Ga0210292_1054471F033054NKMILVNSMFNLVLQTKDFSANSLKQLMSNNETKFKNFFYQATNNKFVEQFIEPNIQDIEYITNIAKWTIEFFEIISAAQVFGTIYDRLKWKIVDHTFCIWLGAVSKCDYGIHMSFLGLMVAMYSLTMSISMQFLELPPSMIFREIELNAFRLGLWWVTSKNLYYWYNKKISEKYAEGRFRPIDRAEKMALYDQMIGSDTRRTIKMWKWTIRFIVLNLLIRIFEIFTKSVRKNMENKKKLKN
Ga0210292_106527Ga0210292_1065271F011303PGEPKCKKFEDWKKKSEAFLASFKNAKRSIPKGAKPIIVQSKKDEVEVIYPEQCMFTWTGGLADAYPNCTLASGDKSKIFIYNRVLLNAKGECNYYQPVFSSNDFKGADRAEDTDSLLDQIYQEFNAGNERFADDMKVEFPVVGKTDKAGMFDLFSKFGGCQRAMLKGCVPVNMSTGKDEIFEGIVPCVYSFKWSAALNETFKLELADGADVVLTSYDCVKIKSGKVISFAPHFDSAANIKPAGKSGAA
Ga0210292_107844Ga0210292_1078441F026746MSKQVILSMLAQGNTGDELLSILDVIVSDIEQEGIDNCAEVFAN
Ga0210292_111741Ga0210292_1117412F041807MARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLL
Ga0210292_112581Ga0210292_1125811F067774MLKLNLKSQDNSLKNLKSSLACYDVSESRFFESNVRKKNDSILLDFGLKHNLRCDDLRINLKLSNPITSKLKDLETPYNDILCDFDAYRKIQSNNELLKLFKEKFNSKSFLKGRLLNGTKRGFSIGVAGVVGFLSMNNTVKINKDKTAILYIDSINMNQGIVSFSQKNVHKKTNKVLLKL
Ga0210292_113362Ga0210292_1133621F021307MNRILYDSRCRCKEEFSITKKRKPSGRSEGKPLQYPNEIMSKTFQIKYEKKLSLVARFILTSFRNKYLYYAIDDILYLLKANPIERENLLSILYSP
Ga0210292_113862Ga0210292_1138622F041807MASKKRKELTLKFPECFHIKTFNVKSENILSPFAKSILQSLQFKHFYYVRDDLYYRLNRYPNE
Ga0210292_114353Ga0210292_1143531F019482VCSLLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLDEWLSIIKSLEDSSGKSLLDVLDGSGLGNGGITITSGLGLLGGGEGRSELSKELILSHGVVLGGGGDGDNLVCASVSCIASEVAVPSVGATR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.