| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300021580 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0129088 | Gp0215219 | Ga0190294 |
| Sample Name | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-30-1-2_MG |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 87935217 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities From Sediments And Microbial Mats In Various Locations |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine hydrothermal vent biome → ocean trench → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Mexico: Guaymas Basin | |||||||
| Coordinates | Lat. (o) | 27.0074 | Long. (o) | -110.591 | Alt. (m) | N/A | Depth (m) | 2001 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014681 | Metagenome / Metatranscriptome | 261 | Y |
| F051696 | Metagenome | 143 | N |
| F081982 | Metagenome | 113 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0190294_1000024 | All Organisms → cellular organisms → Bacteria | 8937 | Open in IMG/M |
| Ga0190294_1016513 | Not Available | 665 | Open in IMG/M |
| Ga0190294_1016999 | Not Available | 658 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0190294_1000024 | Ga0190294_10000249 | F051696 | MSRVLVSIILALTVIAAGCGTTQPTSAPAAPEDVLSIWHSPPSPQGYPPDMSGEVHLGKSGSPDSELETDSLVVQNRQWLDIVVESRNIRLFFYLREPGAVSFEVVQSYSEYSQEKPTLESLVNPHFNPTTGRILYGQPVPEETEMAEDTIYSVAIRLFAEGLRNSTDVDSKYTIRFINSNATEEADISYEVYKLNTTPDWGYTYYDDILGPWMMQQLGGAYSESKWEQLYEEWYEQFE |
| Ga0190294_1016513 | Ga0190294_10165131 | F081982 | MASNIFEGVYRIVHVDANDNTIADLIEMRSEQFGIADAASGTEATYETDLQKLPKLPKINDILAQDDKLVIKVKADSDVGVDIDDDGCYILVPVTMRNARTGVVYPRILAYVDFTDDIDADTTLKAGKWYNWLHYTIPAQTELKLGVSMPDVRTASALSLQWDPDITD |
| Ga0190294_1016999 | Ga0190294_10169991 | F014681 | MKMLNKLMAFLMAMTSELKDDTRAMIDLTIVLAIGVAFVGLMVVAYIIFTVSDSLNATGAAANTIANITTGFDDAVALILIAITIFILAIAISALLMLRGRNN |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |