| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300021111 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063444 | Gp0053456 | Ga0214183 |
| Sample Name | Freshwater microbial communities from Trout Bog Lake, WI - 30APR2008 epilimnion |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 16803924 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Synurophyceae → Synurales → Neotessellaceae → Neotessella → Neotessella volvocina | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → epilimnion → lake water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Trout Bog, Vilas County, Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 46.041 | Long. (o) | -89.686 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001145 | Metagenome / Metatranscriptome | 765 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0214183_103814 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Synurophyceae → Synurales → Neotessellaceae → Neotessella → Neotessella volvocina | 889 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0214183_103814 | Ga0214183_1038142 | F001145 | MTWNSFSFFLNSEETEAFLQLNPNILETNLVNILILIGLLLYGNKVSFSVSLENRQKEIIQTIENAQKDVLNASNYYYLAEKGFAQSVFWLQCWKTLYQKDKVDLVNNKYTLVKTGLLDTFSTTENLIKNFENKAFITLQQYMIFVTASRLLRKFLFLSEAEQSKLIEVTISKLGGSKK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |