Sample 3300018624

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300018624

3300018624: Metatranscriptome of marine microbial communities from deep sea water colum in Eastern Mediterranean Sea - KM3-5

Overview

Basic Information
IMG/M Taxon OID	3300018624 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0129122 \| Gp0217197 \| Ga0193577
Sample Name	Metatranscriptome of marine microbial communities from deep sea water colum in Eastern Mediterranean Sea - KM3-5
Sequencing Status	Permanent Draft
Sequencing Center	Woods Hole Oceanographic Institution
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	19263251
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Metatranscriptome Of Marine Microbial Communities From Deep Sea Water Colum In Eastern Mediterranean Sea
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Metatranscriptome Of Marine Microbial Communities From Deep Sea Water Colum In Eastern Mediterranean Sea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	mediterranean sea biome → marine benthic feature → sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	Eastern Mediterranean Sea
Coordinates	Lat. (^o)	36.29	Long. (^o)	15.39	Alt. (m)	N/A	Depth (m)	2200
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061214	Metagenome / Metatranscriptome	132	Y
F077438	Metagenome / Metatranscriptome	117	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0193577_107995	All Organisms → cellular organisms → Bacteria	737	Open in IMG/M
Ga0193577_112552	Not Available	501	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0193577_107995	Ga0193577_1079951	F077438	VERPFTQSRFETLFLWNLQVEISSDLMPTVEKEIS
Ga0193577_112552	Ga0193577_1125521	F061214	VISARCRLVNGFANLTKIGLALKETPINGGLNDEGQTQSY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.