| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300018506 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117946 | Gp0216900 | Ga0192990 |
| Sample Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001306 (ERX1782389-ERR1712009) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 2032256 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Pseudodiaptomidae → Pseudodiaptomus → Pseudodiaptomus poplesia | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Pacific Ocean: TARA_093 | |||||||
| Coordinates | Lat. (o) | -34.0614 | Long. (o) | -73.1066 | Alt. (m) | N/A | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001694 | Metatranscriptome | 650 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0192990_100483 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Pseudodiaptomidae → Pseudodiaptomus → Pseudodiaptomus poplesia | 542 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0192990_100483 | Ga0192990_1004831 | F001694 | ASAASSNAVTCEECQEGAAGLVDHLLTEESLAEQGSFLKALVCPQLDDVAACEANVDMWFPDMAGCIYNHFVLEGDVCSRLGLCKKAAIFTPRDWTCEECTDVLARTSAYMADEATIAEAVIYLQGDCFCGQDGHTDDCADLVTAIAPLAMPVLAQILVEQTVELCSEVVGVC |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |