NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017832

3300017832: Feedstock adapted compost microbial communities from Newby Island compost facility, Milpitas, CA, USA - Passage 4_SG



Overview

Basic Information
IMG/M Taxon OID3300017832 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053053 | Gp0053389 | Ga0181858
Sample NameFeedstock adapted compost microbial communities from Newby Island compost facility, Milpitas, CA, USA - Passage 4_SG
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size369208357
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria4
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFeedstock Adapted Compost Microbial Communities From Newby Island Compost Facility, Milpitas Ca
TypeEngineered
TaxonomyEngineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost → Feedstock Adapted Compost Microbial Communities From Newby Island Compost Facility, Milpitas Ca

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationNewby Island compost facility, Milpitas, CA
CoordinatesLat. (o)37.454581Long. (o)-121.928712Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007999Metagenome341Y
F036417Metagenome / Metatranscriptome170Y
F098955Metagenome / Metatranscriptome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0181858_1000710All Organisms → cellular organisms → Bacteria16280Open in IMG/M
Ga0181858_1002047All Organisms → cellular organisms → Bacteria9697Open in IMG/M
Ga0181858_1005197All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium5490Open in IMG/M
Ga0181858_1012036All Organisms → cellular organisms → Bacteria2940Open in IMG/M
Ga0181858_1026792All Organisms → cellular organisms → Bacteria1534Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0181858_1000710Ga0181858_10007107F007999VDEAWERRLARAARARANLVAALRECCELADAVEAFEGEELLEVLSHLDGLRFVMAESAQILQGVVRGLEAYEK
Ga0181858_1002047Ga0181858_10020476F036417MVYYARVPIRQLIPTVLVRLATDEGEVVFRARWNRSPLELQRSILFRLRQGTHLWFETEWGHSICFKPESVWGAVVDGR
Ga0181858_1005197Ga0181858_10051974F036417MVYPARVPLRTRIPTVLVRLATDDGEVVFRARWTRSPLELQRNILFRMRRGSLLWFQDEWGHDLCFRPECVYAAMVDGR
Ga0181858_1012036Ga0181858_10120363F098955MDSSAIPVFLAGPFPVLHTARVLHDEQEVELDVALLIGGMPTMLAATRFPLDETWERIQRALSSGDARLAVAGVPHEAQSITGAPEIYPSAYVGLECANGERLVLAHIKGPDRQQEAEGYARSVISAILEGRTPAELGELIED
Ga0181858_1026792Ga0181858_10267922F098955MDPSAIPVFLAGPFPVLHSANVLEREAEVQLDVGLIIGGLPTILAATSFPLDETWERVEAALSSGDARLGVAGIPHQVESPLGDLEIFPSAYIGLECANGERLILAHIRGLDPNQDPESYAREVIAALLNGQSPAELGELIED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.