x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300017248
3300017248: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium, 13 C, 21 psu salinity and 311 ?mol photons light - Pseudopedinella elastica CCMP 716 (MMETSP1068)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300017248 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0212242 | Ga0186530 |
| Sample Name | Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium, 13 C, 21 psu salinity and 311 ?mol photons light - Pseudopedinella elastica CCMP 716 (MMETSP1068) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Center for Genome Resources |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 49752468 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Location Information |
| Location | Atlantic Ocean |
| Coordinates | Lat. (o) | 43.0 | Long. (o) | 68.0 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
| F051149 | Metagenome / Metatranscriptome | 144 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
| Ga0186530_109291 | Ga0186530_1092911 | F051149 | MGAGASAPGALEALPDPVTEAAALSLLGDCFDRADWETISGGTGQVKKETFIVTITVRNHAPSLRAWLEFWRIDELEDILLSLDVMTPSDLAILEVKEIEKVGLKAVQRHHFKKAMAHSKYLEAIAFDRPPSPLNLWLETWRLDRLLKSLYDLGVDVKEDIIDMSDNDAKMMNMRLLEECRWKQATGQLIHVIRAFDFADNTRASTPSLTTWLESLKLEELDEPLKELGVCELVDLGDLSMRQLEALQLNRLQRKHWDMGLIQVLKAKKEAALDGKNDDPTFRGWLSSWRLVRLLAVMNELGAYVQQDLLDLEPNQYSLLKMRPLEAIRFEQAMIQIENEFGALDKHL |