x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300017241
3300017241: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in f/2 medium, 13 C, 21 psu salinity and 250 ?mol photons light - Thalassiosira sp. NH16 (MMETSP1071)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300017241 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0212015 | Ga0186303 |
| Sample Name | Metatranscriptome of marine eukaryotic communities from Pacific Ocean in f/2 medium, 13 C, 21 psu salinity and 250 ?mol photons light - Thalassiosira sp. NH16 (MMETSP1071) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Center for Genome Resources |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 39110552 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi | 1 |
| All Organisms → cellular organisms → Eukaryota → Sar | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Location Information |
| Location | Pacific Ocean |
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F067805 | Metagenome / Metatranscriptome | 125 | Y |
| F099352 | Metatranscriptome | 103 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0186303_117948 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi | 786 | Open in IMG/M |
| Ga0186303_120671 | All Organisms → cellular organisms → Eukaryota → Sar | 566 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0186303_117948 | Ga0186303_1179481 | F099352 | MGVFNGAEAFKGLGAPSLKSEVSVSSNTNRVILDSQELNAASTAFNLCCAEAYSRFTELKRLKLHPGNMTRERDDVESCSADVFNGIQSTCSTQFEAVKSCLSDNPDEWAKCAAARRELEVCSVRNKFGELKKA |
| Ga0186303_120671 | Ga0186303_1206712 | F067805 | MGKKSKTKEEELTLSKKDQKKVDKLTAQIPYHEGRSNLEEVTKIKEQVASIWEKAREAQY |
