NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017079

3300017079: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium, 13 C, 21 psu salinity and 150 ?mol photons light - Cyclotella meneghiniana CCMP 338 (MMETSP1057)



Overview

Basic Information
IMG/M Taxon OID3300017079 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0128947 | Gp0212243 | Ga0186531
Sample NameMetatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium, 13 C, 21 psu salinity and 150 ?mol photons light - Cyclotella meneghiniana CCMP 338 (MMETSP1057)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size41006879
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)43.8442Long. (o)-69.641Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041807Metagenome / Metatranscriptome159N
F051162Metagenome / Metatranscriptome144Y
F067805Metagenome / Metatranscriptome125Y
F099352Metatranscriptome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186531_102829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3190Open in IMG/M
Ga0186531_108542All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana1669Open in IMG/M
Ga0186531_109817All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1500Open in IMG/M
Ga0186531_117470All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales748Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186531_102829Ga0186531_1028291F041807MACSSRGELTLKFPEYFHIKTFNIKSDKVLSPLAKSILQSLQFKHFYYVRDDLDYLLKSHPIEKDFLL
Ga0186531_108542Ga0186531_1085422F067805MARKLPKEEEITLSKKDQKKVDKLEAQIPYHEGRGNKEEVEKIKQQVAAIWTKTREAALA
Ga0186531_109817Ga0186531_1098173F051162LSARATLPSLYVPTTRVSFHGMPLVKVFARAGMNKAIPLVALQSKLCEIWGTKPETTKLMLSRVEDWTSDHKEDCYIDIRAYGKSERTRDFVLEGMKKVQNAFAEFDLVANVRLETYDGEKYFHVPP
Ga0186531_117470Ga0186531_1174701F099352MSKPDGSEIAFKGDILDLDRKLSVTATDNRVLLDSKDLNAASTPFNLCCAEAYAKFTDMKRLKVHPIKMTKERDAVESCSANVYQGIQSNCLEQFEAVKQCLSDNPKNWAACAEMRKALDVCSVRSGLGEIKQAL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.