NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016870

3300016870: Metatranscriptome of marine eukaryotic communities from unknown location in f/2 medium in seawater w/o silicate, at 15 C, 31 psu salinity and 717 ?mol photons light - Amoebophrya sp. Ameob2 (MMETSP0795)



Overview

Basic Information
IMG/M Taxon OID3300016870 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0211892 | Ga0186180
Sample NameMetatranscriptome of marine eukaryotic communities from unknown location in f/2 medium in seawater w/o silicate, at 15 C, 31 psu salinity and 717 ?mol photons light - Amoebophrya sp. Ameob2 (MMETSP0795)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size26835830
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000342Metatranscriptome1262Y
F001051Metatranscriptome792Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186180_105628All Organisms → cellular organisms → Eukaryota → Sar1612Open in IMG/M
Ga0186180_107367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1174Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186180_105628Ga0186180_1056281F000342MLPAQPGAKAQTVFTPGKKRRINLVAVCMNIFLPWFLFAALFAILSFSFHYQQPAAAWLCVGIGLFVSLGAIGIAFASRGQNRDPSWYLFSGLMLFLAVVLAAIFGDMNFWYNMQPFYDIENLNTYPSVDPATQTGQRLMDAGRVYFADNTRLDTSKAMGFKNLDLYCVAPIVNGNQALETYDFWAVGLNCCSGVSSDFRCGEFNNPHARSGLRLMRDDQRPFFRLAVQQAAAAHHLKSTHPLFFYWLQDPVGEMNSYRDQGFKYYLLGIFTHFAFNLFCTTVAVIGFSRIGK
Ga0186180_107367Ga0186180_1073671F001051MGSSISTDTIPVLCTMVDVHNAKAQDQFYFANVSTGGAATKVIGRSQTLSVEVGISTILTLVVYECPEPQFSPEYARCLGVIRFPIERLAERYSSGIFQQWFNLDTKADPRAPPGDFQQINGKFEASYSGAIQDVYAPKICLSIIGSSFEVARSGRSSCSIFVSEDVKTQAGPDIKALIASHKQQAAYIDSMHEELRRLNTPSYRPVGGGQPSDPRAAMAAGSGAGGGMGFVPSSLGQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.