x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300016798
3300016798: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in K medium, 20 C, 35 psu salinity and 168 ?mol photons light - Prasinoderma singularis RCC 927 (MMETSP1315)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300016798 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0211999 | Ga0186287 |
| Sample Name | Metatranscriptome of marine eukaryotic communities from Pacific Ocean in K medium, 20 C, 35 psu salinity and 168 ?mol photons light - Prasinoderma singularis RCC 927 (MMETSP1315) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Center for Genome Resources |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 16697115 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare | 2 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Location Information |
| Location | Pacific Ocean |
| Coordinates | Lat. (o) | -34.53333333 | Long. (o) | -72.41666667 | Alt. (m) | N/A | Depth (m) | 0 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F044853 | Metatranscriptome | 153 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0186287_106241 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare | 932 | Open in IMG/M |
| Ga0186287_106384 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare | 908 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0186287_106241 | Ga0186287_1062411 | F044853 | MRSVTSSALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDNGPDGAVDPSSFDTQNIIECHQQVTNGMHYNFVLNAMDGVLFCDVQWPPAGGGLPEYDCSLHEHAKNRYPCVDPGTCSKHCLHHGCKQA |
| Ga0186287_106384 | Ga0186287_1063841 | F044853 | MRSVTSSALALALALAVGGASAQLEGGGGGFYEECPHPHSDNDIDIVVANTYNSQGEKPKCGPTGMDGEVDPNTLDTQNIVECHQQIVAGTNYNFVLNAMDGVLFCDVQWPPAGGGLPEYDCSLHEHAKNRYPCVDPGTCSKHCLHHGCKQA |
