| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014857 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121295 | Gp0151502 | Ga0134330 |
| Sample Name | Human bile duct microbial communities from gallstone patients in Hangzhou, China - B6_bile |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Institution of Radiation Medicine |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 3468581 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Bile Duct Microbial Communities From Gallstone Patients In Hangzhou, China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Excretory System → Liver → Bile → Human Bile Duct → Human Bile Duct Microbial Communities From Gallstone Patients In Hangzhou, China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Hangzhou | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077438 | Metagenome / Metatranscriptome | 117 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134330_11095 | Not Available | 823 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134330_11095 | Ga0134330_110951 | F077438 | THRVEPSFIQSSFETLFLWNFQVEISRDLTPILDMEISSY* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |