


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014832 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118585 | Gp0137247 | Ga0119905 |
| Sample Name | Activated sludge bacterial and viral communities from EBPR bioreactors in Brisbane, Australia - M90108 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | California Institute of Technology |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 488448410 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia |
| Type | Engineered |
| Taxonomy | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Australia: Thorneside Wastwater Treatment Plant | |||||||
| Coordinates | Lat. (o) | -27.485973 | Long. (o) | 153.190699 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012473 | Metagenome / Metatranscriptome | 280 | Y |
| F035426 | Metagenome / Metatranscriptome | 172 | N |
| F036109 | Metagenome / Metatranscriptome | 170 | Y |
| F100051 | Metagenome / Metatranscriptome | 103 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0119905_1064998 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 996 | Open in IMG/M |
| Ga0119905_1074839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
| Ga0119905_1129179 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0119905_1064998 | Ga0119905_10649981 | F036109 | MPGMRHRRILLPFVTIGTLFAFRMLAIVTPVLGAAMIMMALDRH* |
| Ga0119905_1074839 | Ga0119905_10748391 | F100051 | RLICAVFGHRYVVERVLNHGARKVGCTRCGKHWGMHDGTRSFVPWDGELEALYAPGGILAQASGDVPPNA* |
| Ga0119905_1129179 | Ga0119905_11291791 | F012473 | MIGFYDVIVAATALERGSSVATFNRRHFECVPGLKVIEPQ* |
| Ga0119905_1199707 | Ga0119905_11997071 | F035426 | MLASDVNCFWALEQDQESYNREVYLPDAYVEVLINVGAPLMLESEYGMLELPRAFVNPLQNKPLRIRAAGFCQMISMQLYPWAVKPILNLEADPSTVHVIGLDAGWQRFADYLTQIVAHRGYGEAIDCYQEFVCKTAYRHKHDLTLIRTAGHLLH |
| ⦗Top⦘ |