| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014699 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118444 | Gp0135674 | Ga0121455 |
| Sample Name | Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal/plastic -P00164 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Weill Cornell Medical College |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 66125498 |
| Sequencing Scaffolds | 0 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: New York City | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -73.93 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F081964 | Metagenome | 113 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0121455_101406 | Ga0121455_1014067 | F081964 | MSAATASCYRQQIVRAVTGRAPAITWSVTNSGALDRICARLVEAERAAEILQAKGYGKPGLLLHEVAALVPSK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |