| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014652 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121293 | Gp0151491 | Ga0134319 |
| Sample Name | Alkaline hot spring microbial communities from Galicia, Spain - Lobios hot spring |
| Sequencing Status | Permanent Draft |
| Sequencing Center | The University of A Coru?a |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 28972921 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Alkaline Hot Spring Microbial Communities From Galicia, Spain |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Alkaline Hot Spring → Alkaline Hot Spring Microbial Communities From Galicia, Spain |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → hot spring → alkaline water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Spain: Lobios, Galicia | |||||||
| Coordinates | Lat. (o) | 41.86113 | Long. (o) | -8.1062 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023133 | Metagenome / Metatranscriptome | 211 | Y |
| F099502 | Metagenome / Metatranscriptome | 103 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134319_100112 | All Organisms → cellular organisms → Bacteria | 28840 | Open in IMG/M |
| Ga0134319_105362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 872 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134319_100112 | Ga0134319_10011210 | F099502 | MAEKANQESAIGTIIGWGSLGIFALWFAYQVASPLLIGEQWAEKQQDAIELVKNSKPLGNDTLYDMIRAYSLKAKENDFFVGEFSWSAIQKDGPEYEVTLLWTEGEQKKVALWRVNLENKEVRPQGDAASLPQRLAAGPPKKPAGS* |
| Ga0134319_105362 | Ga0134319_1053621 | F023133 | MTIRPLNRSLAKQDPEGTFESPLGIVEERLFTRGEKIATLNRWRQAILEELAALGEVRRARLLGE |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |