


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014243 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121326 | Gp0152458 | Ga0135126 |
| Sample Name | Indoor hospital air microbial communities from San Diego, USA - 174_L1_2014-4-30 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | San Diego State University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 2144229 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Indoor Hospital Air Microbial Communities From San Diego, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Air → Indoor Air → Unclassified → Unclassified → Indoor Hospital Air → Indoor Hospital Air Microbial Communities From San Diego, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Aerosol (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: San Diego, California | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F065766 | Metagenome / Metatranscriptome | 127 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0135126_10131 | Not Available | 779 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0135126_10131 | Ga0135126_101312 | F065766 | MADEKKDEGAGDPIKILLEEALERQRNAMMDSFAQILQRLPR |
| ⦗Top⦘ |