x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300014163
3300014163: Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In3P SAF170 SPAdes reassembly
Overview
| Basic Information |
| IMG/M Taxon OID | 3300014163 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0095512 | Gp0111877 | Ga0181460 |
| Sample Name | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In3P SAF170 SPAdes reassembly |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 6150225 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1 |
| Not Available | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Clean Room Microbial Communities From Nasa Spacecraft Assembly Facility At Jet Propulsion Laboratory, Pasadena, California, Usa |
| Type | Engineered |
| Taxonomy | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room → Clean Room Microbial Communities From Nasa Spacecraft Assembly Facility At Jet Propulsion Laboratory, Pasadena, California, Usa |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Surface (non-saline) |
| Location Information |
| Location | USA: Jet Propulsion Laboratory, Pasadena, California |
| Coordinates | Lat. (o) | 34.1 | Long. (o) | -118.1 | Alt. (m) | N/A | Depth (m) | 0 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F045048 | Metagenome / Metatranscriptome | 153 | Y |
| F046363 | Metagenome / Metatranscriptome | 151 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0181460_10185 | Ga0181460_1018514 | F046363 | MRWFLVHGFGRDGFRSMILDALACINMYCNIERKIMKNQASSPGFGIQGKISVHMCFMCYALTLFIFFV* |
| Ga0181460_10366 | Ga0181460_103666 | F045048 | VFNKGNSKGLIDSIPKGGHLAPNSTVGDKALWKNDQNMAKKNNASDAINKATPIFIPLCTAKV* |
