NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013737

3300013737: Coral viral communities from the Great Barrier Reef, Australia - Pocillopora damicornis (fresh isolate) - PDam_DNA_MDA_NLN



Overview

Basic Information
IMG/M Taxon OID3300013737 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0118633 | Gp0137663 | Ga0117782
Sample NameCoral viral communities from the Great Barrier Reef, Australia - Pocillopora damicornis (fresh isolate) - PDam_DNA_MDA_NLN
Sequencing StatusPermanent Draft
Sequencing CenterAustralian Institute of Marine Science
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size25608059
Sequencing Scaffolds6
Novel Protein Genes7
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Actiniaria → Edwardsiidae → Nematostella → Nematostella vectensis1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina2
All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameCoral Viral Communities From The Great Barrier Reef, Australia
TypeHost-Associated
TaxonomyHost-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Coral Tissue → Coral Viral Communities From The Great Barrier Reef, Australia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal corpus

Location Information
LocationAustralia: Great Barrier Reef
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023365Metagenome210Y
F023524Metagenome / Metatranscriptome209Y
F035988Metagenome171Y
F059829Metagenome / Metatranscriptome133Y
F073070Metagenome / Metatranscriptome120Y
F074384Metagenome / Metatranscriptome119Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0117782_101716All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Actiniaria → Edwardsiidae → Nematostella → Nematostella vectensis1255Open in IMG/M
Ga0117782_103396All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae951Open in IMG/M
Ga0117782_103936All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina913Open in IMG/M
Ga0117782_113727All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes573Open in IMG/M
Ga0117782_115661Not Available540Open in IMG/M
Ga0117782_118572All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina508Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0117782_101716Ga0117782_1017161F023524KLYIGETRRRLGDRFREHLRDVELNDKDASKHVVRHFNLPNHSKQHMAVYGLSLHLGSSESRKTLEQKFIFQIGTLNPHGINERFSFN*
Ga0117782_103396Ga0117782_1033961F073070NRYGHRSGYQLWDNSMVVRNLFLAEEGGKTKVPTHISYEEWDCTALFQATIYARSFATSDSKGHYKTLGELYVKHHKVPLGKFHPTVVSPSGNTAETFALAIDQLRLLRNSLCHSDKSEIDKLTFDQYVQLAKEAFKALGIMTDPIDAVGGLTESDFPTKEVRKLEESFRQETRSYIECLEEVQSSVDKLVAQGNAIAVLEGKRTFSLFPSHSSIAV*
Ga0117782_103936Ga0117782_1039361F023524MWCYILYNHLYVQSYECRRLGDRFRERLRNVTRNDKATSKPVAKHLNLATYCIQHMAVSGLSLHLGSSESRKTPEQKFIFQISTFNLHGIDARFSFD*
Ga0117782_106341Ga0117782_1063412F023365ANIGEITEIINASELTLEVGSDVYIMLKNLQVHVGFVENRTATTGAGALYTLGKGDHFFTFTLVLTTPELSSLNNLVGPDSDGDTTSTAWKIVAKDVSAATKTMAATGFLREYDVSKPEEGKIEIDCFIRITGNTITIT*
Ga0117782_113727Ga0117782_1137271F035988VKQLLETREIPLDKEDCNQTNGECTLITKPVIFIKGIQTRSQLEHYCQVPAATVRNWSKGRYTLRILINPATPKTSQIGVYAKFEGMTEGATGSQWVPLTSKGELEDKMLRCIQDRLQGGNCENIK*
Ga0117782_115661Ga0117782_1156611F059829VDVSPALNSPTGLVPANVNGPISFRVLEHSFMSAVIGNERPKIGLTTNRCLGYIAETFHPSQRVDTVDPEINWPGMKFNTATILVGQYVPGADGVNDPDLGDYSAANETFWWLNPGPQGDDAYLRLYIAASEAFAFGFTGFKGARDDNQVSGQIQFAGNLTGKAPRYSRGLYGITSA*
Ga0117782_118572Ga0117782_1185721F074384KHMAVSGLSLHLGSLESPKTQEQKCFFQIGTLNPHGINERFSFN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.