| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013312 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127538 | Gp0206468 | Ga0173631 |
| Sample Name | Solar panel surface microbial communities from Valencia, Spain - panel 3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Lifesequencing S.L. |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 123257707 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Solar Panel Surface Microbial Communities From Valencia, Spain |
| Type | Engineered |
| Taxonomy | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Solar Panel Surfaces → Solar Panel Surface Microbial Communities From Valencia, Spain |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Surface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Valencia, Spain | |||||||
| Coordinates | Lat. (o) | 39.4561165 | Long. (o) | -0.3545661 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037234 | Metagenome / Metatranscriptome | 168 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0173631_1126740 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 503 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0173631_1126740 | Ga0173631_11267401 | F037234 | MNEYLILDPKPSDLTMIRVIKARMVYRCKDIQRIVVS* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |