NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013069

3300013069: Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - RNA 5th pass 37_C Kraft MG (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300013069 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0127392 | Gp0191765 | Ga0164282
Sample NameEnriched Miracle-Growth compost microbial communities from Emeryville, California, USA - RNA 5th pass 37_C Kraft MG (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size58163437
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1
Not Available3
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameLignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → anthropogenic environment → compost
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Emeryville, California
CoordinatesLat. (o)37.83Long. (o)-122.29Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005068Metagenome / Metatranscriptome413Y
F011188Metagenome / Metatranscriptome294Y
F011352Metagenome / Metatranscriptome292Y
F025700Metagenome / Metatranscriptome200Y
F056688Metagenome / Metatranscriptome137Y
F065880Metagenome / Metatranscriptome127Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0164282_137043All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium944Open in IMG/M
Ga0164282_161775Not Available625Open in IMG/M
Ga0164282_173978All Organisms → cellular organisms → Bacteria1133Open in IMG/M
Ga0164282_175076Not Available695Open in IMG/M
Ga0164282_188361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi532Open in IMG/M
Ga0164282_189271Not Available1643Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0164282_137043Ga0164282_1370431F056688MDSDEAEQLCDALAELASKGPAQDARALVEAKGILRKITHAPEANAHVRARASDVERALTGWLDADERFHRVLKDYRKDIDALIDRLHSAMREATRFKAR*
Ga0164282_161775Ga0164282_1617752F025700MNSERRKLLILENDRALRRELETIFADLDVVCSEASEQTLALVRRVEP
Ga0164282_173978Ga0164282_1739782F065880AIRSTPMKGELPMDREAVQVKLTDGDWQPAVYQDGQFFDLYGLPLDYRKITSWRPAGGSPNGSAAADRRSARL*
Ga0164282_175076Ga0164282_1750761F005068AARPPEKPAARTTPKKKPLGRVRAREQRSPKTLEETLEILGASELEIDTGVEVLNDTGVRHLRVEVQKDTPFAKLLDRLTERVRRN*
Ga0164282_188361Ga0164282_1883611F011188MDELPAGEEIDGEEMIEVEFRVVPGSDDENDPENNAVIAGLDLVDLINLRDALQQEIDNYALSALEAEANRLAEDMG*
Ga0164282_189271Ga0164282_1892711F011352RYYFRLTDGKQTFNNHTGIDLAGPAAAREDAVAFARSLTQGAVMPGFDWSGWLVSITDEHGRQVDEVPIDAVG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.