


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300012622 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118646 | Gp0138034 | Ga0118097 |
| Sample Name | Human skin bacterial and viral communities - University of Pennsylvania - MG100370 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Pennsylvania |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 22700208 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Skin Bacterial And Viral Communities - University Of Pennsylvania |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | ||||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F105149 | Metagenome / Metatranscriptome | 100 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0118097_108147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis | 501 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0118097_108147 | Ga0118097_1081471 | F105149 | YQGGSSRKQGPRLAMRDAEDEPPRDAPVRACEWPSKDFMDQAGIKEEFNAYVRNADLVSFEADKCRQYHYLTSSFVRRFEFSSSHNSQTVLFDLYENSYTMDLEDFTTACKLPSGVILMILPNLNLEISLRILLWKNLGT* |
| ⦗Top⦘ |