| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300012075 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121619 | Gp0175728 | Ga0153917 |
| Sample Name | Attine ant fungus gardens microbial communities from Florida, USA - TSFL001 MetaG |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 173489236 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Leucoagaricus → Leucoagaricus leucothites | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Fungus → Fungus corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Florida, Paynes Creek Historic State Park | |||||||
| Coordinates | Lat. (o) | 27.6206 | Long. (o) | -81.814 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F048028 | Metagenome | 148 | Y |
| F054481 | Metagenome | 139 | Y |
| F061419 | Metagenome | 131 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0153917_1022700 | Not Available | 1103 | Open in IMG/M |
| Ga0153917_1044916 | Not Available | 711 | Open in IMG/M |
| Ga0153917_1072579 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Leucoagaricus → Leucoagaricus leucothites | 530 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0153917_1022700 | Ga0153917_10227001 | F054481 | MSAIDIYAITNSSDEEFPELLLLRHVDIELHPRGISRPLVGRNGIYLLGIHNCGAIRIYVSHNTTIPPTTEVLGPLESVSGLTISHRQFGTMVSFSYENHHRIQMATYDLASHPSHYRWLRLNILEISNNRTIVKDLAGLDDNAGRVVIRRSGTSNRFLIMDLV* |
| Ga0153917_1044916 | Ga0153917_10449161 | F048028 | MKSLVESMTILANQLNRVKKAPNSEELCHTIHEFPRIMEEVMDFIQEWLKNWTRMYEFM* |
| Ga0153917_1072579 | Ga0153917_10725791 | F061419 | PLPASMSGDPPSVILHPKVATSYPSKAVTANLSSPPMPKVVVGFPLLLSQSHCVPGQLEPSSTMLPLGSSDSAFSLQSTLSVRVAIARWKHVDTS* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |