NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300010385

3300010385: Giant kelp blades associated microbial communities from the kelp forest near Monterey Bay Aquarium, California, USA . Combined Assembly of Gp0155292, Gp0155293



Overview

Basic Information
IMG/M Taxon OID3300010385 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0121514 | Gp0155292 | Ga0136809
Sample NameGiant kelp blades associated microbial communities from the kelp forest near Monterey Bay Aquarium, California, USA . Combined Assembly of Gp0155292, Gp0155293
Sequencing StatusPermanent Draft
Sequencing CenterLeibniz Institute
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size413904141
Sequencing Scaffolds8
Novel Protein Genes9
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → Viruses → Predicted Viral2
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameGiant Kelp Blades Associated Microbial Communities From The Kelp Forest Near Monterey Bay Aquarium, California, Usa
TypeHost-Associated
TaxonomyHost-Associated → Algae → Brown Algae → Unclassified → Unclassified → Marine Brown Algae (Kelp) Associated → Giant Kelp Blades Associated Microbial Communities From The Kelp Forest Near Monterey Bay Aquarium, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Surface (saline)

Location Information
LocationMonterey Bay, California, USA
CoordinatesLat. (o)36.619Long. (o)-121.9Alt. (m)N/ADepth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000918Metagenome / Metatranscriptome834Y
F001217Metagenome / Metatranscriptome745Y
F002549Metagenome / Metatranscriptome549Y
F062773Metagenome / Metatranscriptome130Y
F072745Metagenome / Metatranscriptome121N
F078296Metagenome / Metatranscriptome116N
F084839Metagenome / Metatranscriptome112N
F100059Metagenome / Metatranscriptome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0136809_1012310Not Available4490Open in IMG/M
Ga0136809_1034055All Organisms → Viruses → Predicted Viral2558Open in IMG/M
Ga0136809_1103072All Organisms → cellular organisms → Bacteria1398Open in IMG/M
Ga0136809_1111002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1340Open in IMG/M
Ga0136809_1123833All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1261Open in IMG/M
Ga0136809_1144126Not Available1157Open in IMG/M
Ga0136809_1148455Not Available1138Open in IMG/M
Ga0136809_1180639All Organisms → Viruses → Predicted Viral1016Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0136809_1012310Ga0136809_10123103F002549MSKLLKLLGGSAAPLLDKAAEVADRFIDTPAEKKAFIKEAYQQEVLDRKEARELGKNKSTPDILTYVTLFIAIGLATAIFTDFLDWAALTEVQKGLITTFSGFFLRTLGDVYGYWFGSSMGSGDKTKDLTKLMRK*
Ga0136809_1034055Ga0136809_10340551F078296MKNITKTFEEKSYSMSTGFTKDLGLFTVNGTIWSYVNPNTPYKNKYDHEISDIEINYEINGKYCMNAGFKELYEKLYGKDSFTKFEREVAEEFEAAYYETTPYSND*
Ga0136809_1103072Ga0136809_11030722F000918MYQTNQQAWDEVTREFKESKRRTAICQQMFGQDNLIGLTDDQRNKFWESI*
Ga0136809_1111002Ga0136809_11110023F100059MKNSFFPIIILFEKAVKEIQNGPKWKFIAKNYGHGNFFYGPKS*
Ga0136809_1123833Ga0136809_11238333F062773MGLGAAIGNGIPFQDKRNEDIPEICFIITELDDFCEQETVIGDSRMLPELCTNP*
Ga0136809_1144126Ga0136809_11441264F078296MKNITKTFEDKSYSMSTGFTKDLGLFKVNGVVWSYVNFNKDGRGTCDHEINDIELSYEINGTYCRYVGFKELYEKLYGENSFKKFEQQVTDEFEEAYFASTPYPNSQTQYDDRRIIYM*
Ga0136809_1144126Ga0136809_11441265F001217FNRFEKYFIQTALKSAIEQAEVDVLAAETNGKRSIYAPGYFTMVGNEMIEKVSNMTLKKYQD*
Ga0136809_1148455Ga0136809_11484552F084839MNRPYKYITVLDYSNGQVYLYDYDETEMPNAADFVKSRHDLDDVNYMVHQYKPALWTKDVYYCTKEQAYQLTNED*
Ga0136809_1180639Ga0136809_11806393F072745MITFKQFFNENANHHSFIKYKTNFANLTDEQMDQIEYEMGIDWVDYRMERV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.