| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300010239 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121435 | Gp0154470 | Ga0136451 |
| Sample Name | Terrestrial oil reservoir microbial community from Kuparuk Formation, Alaska - K3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Yale Center for Genome Analysis |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 1368912897 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Terrestrial Oil Reservoir Microbial Communities From Alaska |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Produced Fluid → Terrestrial Oil Reservoir Microbial Communities From Alaska |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Alaska, USA | |||||||
| Coordinates | Lat. (o) | 70.4 | Long. (o) | -148.7 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077200 | Metagenome / Metatranscriptome | 117 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0136451_100001469 | All Organisms → cellular organisms → Bacteria | 4640 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0136451_100001469 | Ga0136451_1000014695 | F077200 | MNKFTVIAVETQPNLERIKEYADRYNMTPEEALERKRIGENYFPIRDQKIVAAGVINFFSKEEKIGIMAAVFAGEEKKILDNLAKRLDKIVKTTGKPFFVTGDGRKYALEILAGRAMSYMIEAKQKDQEVIPELQDMIKIITSPKNGYLKPFDTRDSIDIQAAFGLGHDIIPLPEKLQYTNEDLPELAENVKGILLDMMKNYACYAEVQGEKIKPVIYKLNEKVFKTTEIFNFEDRDENDIEKTLDKEELEIER* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |