| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300010217 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121396 | Gp0154003 | Ga0136159 |
| Sample Name | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China ? Region2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DNAVision |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 204455793 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines | 1 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Sitobion Avenae (English Grain Aphid) Hemolymph Microbial Communities From Henan Dengzhou, China - Region2 |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Endosymbionts → Bacteria → Unclassified → Unclassified → Wheat → Sitobion Avenae (English Grain Aphid) Hemolymph Microbial Communities From Henan Dengzhou, China - Region2 |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Henan Dengzhou, China | |||||||
| Coordinates | Lat. (o) | 32.68 | Long. (o) | 112.08 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029983 | Metagenome | 186 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0136159_1013496 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines | 2716 | Open in IMG/M |
| Ga0136159_1035464 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora | 1049 | Open in IMG/M |
| Ga0136159_1046316 | Not Available | 785 | Open in IMG/M |
| Ga0136159_1071848 | Not Available | 779 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0136159_1013496 | Ga0136159_10134961 | F029983 | VLFCCTVGYKWVIVMDDFKFEFNDIYNIVSLYKKNDS |
| Ga0136159_1035464 | Ga0136159_10354641 | F029983 | VSLCCTIGYKWVTVMDCVQFEFNGIILLYKKNDFERRSASQPMILP |
| Ga0136159_1046316 | Ga0136159_10463161 | F029983 | MQLCRTVDYKWVTVMGGITFEFNVIISLYPKNDSERRRF |
| Ga0136159_1071848 | Ga0136159_10718481 | F029983 | VSLCCIEVYKWVAVMVGVKFEFNDIIPLHKKKRFW |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |