NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300010170

3300010170: Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP NP_2300 MetaT (Metagenome Metatranscriptome) (version 2)



Overview

Basic Information
IMG/M Taxon OID3300010170 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0046783 | Gp0111643 | Ga0124949
Sample NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP NP_2300 MetaT (Metagenome Metatranscriptome) (version 2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size25585735
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAnoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → hot spring → microbial mat material
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationUSA: Wyoming: Yellowstone National Park
CoordinatesLat. (o)44.963Long. (o)-110.715Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000642Metagenome / Metatranscriptome965Y
F002970Metagenome / Metatranscriptome517N
F004307Metagenome / Metatranscriptome444Y
F073601Metagenome / Metatranscriptome120Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0124949_106537Not Available1343Open in IMG/M
Ga0124949_112265Not Available715Open in IMG/M
Ga0124949_129529Not Available805Open in IMG/M
Ga0124949_135126All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon1361Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0124949_106537Ga0124949_1065373F073601MLQAKVTCLVMVLPAKRREGQRMFGVLHFAWRCAIKIMACGSIIRTLPVGKKAFVGMGVLLQQE*
Ga0124949_112265Ga0124949_1122651F004307KEGIMFKELVKLGDSNDERPVLNGAYIGRFLGVKERQRPTFDTRLNSEPELEDVFVFEFEVDDEELPQPIRVAKWVRKPPRLSHPGKNGKVSNLYKVIAALYGVSQMTDEQLQNAEEFVISAVGREYQLTIETKPSGWYEIIHVAPVRRARRKEVMSGNEEVPF*
Ga0124949_129529Ga0124949_1295291F000642VSIALALCAVAAALWYMRRREAGAGRLRGWLLLWDELGGWRALSATYGDSGIVADGVTYPASLPVVRVGRDLVWIARCDSAALVEHQALERARESAALASLWRGGGQWLDFLRVAGVVLPAVFAYFTWAQVGALQALVAQILALVGEGR*
Ga0124949_135126Ga0124949_1351261F002970MTFVRYWSVIAMSYSTVVDIIEMLANLNVQYNNAVVPTLRLTSQASWSDAAQLPARIIPVLGGLRLVESGVYTATRATRAVWEIDDLLLVRDVGMGRGVADTATALVEYIEDYVAKLRFAWLQRGDVQLINVSGVVDVVKYGERAYEGVTMTTRFAHLVRSPSI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.