


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300010005 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118857 | Gp0141690 | Ga0120997 |
| Sample Name | Microbial communities associated with xenic strain Fischerella muscicola UTEX 1829 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Oregon State University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 125595532 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities Associated With Xenic Strain Fischerella Muscicola Utex 1829 |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Microbial Communities Associated With Xenic Strain Fischerella Muscicola Utex 1829 |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | UTEX collection | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F102772 | Metagenome | 101 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0120997_100802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 21025 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0120997_100802 | Ga0120997_1008023 | F102772 | MSNDASRLRAILSAASVYLFFEAGLAAQTVDELPDPQEPMLAEPGDWAADFNEAQSACYQGSMRACDSIWLSERVLLDSFLDHYGRTCGGRVDLREIRRANLNCTEAFPGHD* |
| ⦗Top⦘ |