NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006720

3300006720: Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2618 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300006720 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0053074 | Gp0092409 | Ga0031675
Sample NameMetatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2618 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size133027513
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota2
Not Available3
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNortheast of Antigua and Barbuda, North Atlantic Ocean
CoordinatesLat. (o)19.99Long. (o)-52.64Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005911Metagenome / Metatranscriptome386Y
F010768Metagenome / Metatranscriptome299Y
F030135Metagenome / Metatranscriptome186Y
F070259Metagenome / Metatranscriptome123Y
F090441Metatranscriptome108N
F090442Metagenome / Metatranscriptome108Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0031675_1007969All Organisms → cellular organisms → Eukaryota518Open in IMG/M
Ga0031675_1014797Not Available732Open in IMG/M
Ga0031675_1268357Not Available639Open in IMG/M
Ga0031675_1274248All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae546Open in IMG/M
Ga0031675_1327403All Organisms → cellular organisms → Eukaryota650Open in IMG/M
Ga0031675_1348200Not Available953Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0031675_1007969Ga0031675_10079691F090442TVDTSVMNEPNEAIVFHSWKASGKSGIRRGIPANPRKCIGKNVRFTPINVVQKWIFPRTSG*
Ga0031675_1014797Ga0031675_10147971F030135ATLSSFTDIGHATFVGCQFPDAILPGEEAIDLVAGPLN*
Ga0031675_1268357Ga0031675_12683571F005911ATFSVYFFVSLTTLSEDSKQRVAHLYNAYQMGQSIKAKIDGADINQARLGSGDEDQIEAPINELFHNGNFIKLSEMVKKAVIIVSDDPTATARKGYDIGYDTENSGVLIKFAAADGNVIQPDQGDADDTIVADVHLFVNLAGTADTDANAPYVDGTPFYYILMDATTAGLADSLETINSTIYPTGILATNGGGPQAEVSVVLPQDSED*
Ga0031675_1274248Ga0031675_12742482F010768MPDINSPQITNAILEGARTMCEVLRGGYIVHPDPPPNSVITERIRSIYERNKINIEKLFILG
Ga0031675_1327403Ga0031675_13274031F070259MKSESLVIVNHDVTVNDISNFAHTAHHARRVVTAGNFIMS*
Ga0031675_1348200Ga0031675_13482001F090441EVWELATLSFPDSLALGALITRRVIVGCQFPDAASCRKNDCDTFRSHSGT*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.