| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006715 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0092404 | Ga0031670 |
| Sample Name | Metatranscriptome of deep ocean microbial communities from Pacific Ocean - MP1481 (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 101278081 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1 |
| Not Available | 3 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | South of Fiji, South Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -28.41 | Long. (o) | 179.14 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030135 | Metagenome / Metatranscriptome | 186 | Y |
| F047906 | Metagenome / Metatranscriptome | 149 | N |
| F067833 | Metagenome / Metatranscriptome | 125 | Y |
| F071270 | Metagenome / Metatranscriptome | 122 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0031670_1002756 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 693 | Open in IMG/M |
| Ga0031670_1010765 | Not Available | 783 | Open in IMG/M |
| Ga0031670_1115477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 666 | Open in IMG/M |
| Ga0031670_1155814 | Not Available | 528 | Open in IMG/M |
| Ga0031670_1270344 | Not Available | 729 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0031670_1002756 | Ga0031670_10027563 | F067833 | QTKLTVLLHHVKTKVYGIVAMANVFQHHMYVMAQVNFVTQAGVLTVPMVQMKA* |
| Ga0031670_1010765 | Ga0031670_10107651 | F030135 | ELATLSSFTDIGHSTFVGCQLPDAILPGEEAIDLVAGPLN* |
| Ga0031670_1115477 | Ga0031670_11154771 | F071270 | ANAYSMALEHLEAGIKAAAEENIDLNAYGQALVWKLIEKYQEAGRSNDDIVSEIKYTLDNIADDNTFHVSRN* |
| Ga0031670_1155814 | Ga0031670_11558142 | F047906 | VALAAKFTQKRTVTKERTPDAIRVPVAHRPVVGLGVLAVRWHHAVTKVRVALRLDMLAVAKRVSRVEIKFAVTAKAGLVQTQRLAVANAVANAVVIRIVVAERVA* |
| Ga0031670_1270344 | Ga0031670_12703441 | F030135 | ELATLSSFTDIWHSTFAGCQFPDAILPDKEAFDLVAGPLN* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |