NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006435

3300006435: T18 (1) (Live), Syntrophic microbial communities from an anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom ? benzoate enriched in lab, transferred 6 times



Overview

Basic Information
IMG/M Taxon OID3300006435 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0117429 | Gp0123698 | Ga0099706
Sample NameT18 (1) (Live), Syntrophic microbial communities from an anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom ? benzoate enriched in lab, transferred 6 times
Sequencing StatusPermanent Draft
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size44792854
Sequencing Scaffolds9
Novel Protein Genes9
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Archaea2
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1
Not Available3
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. PtaU1.Bin2081
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSyntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biome → river → sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUK (Newcastle upon Tyne)
CoordinatesLat. (o)54.971158Long. (o)-1.703654Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048390Metagenome / Metatranscriptome148Y
F050029Metagenome / Metatranscriptome146Y
F050777Metagenome / Metatranscriptome145N
F054136Metagenome140Y
F090409Metagenome108Y
F101218Metagenome / Metatranscriptome102Y
F102132Metagenome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0099706_101439All Organisms → cellular organisms → Bacteria → Proteobacteria2984Open in IMG/M
Ga0099706_102550All Organisms → cellular organisms → Archaea2108Open in IMG/M
Ga0099706_102838All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1988Open in IMG/M
Ga0099706_104156All Organisms → cellular organisms → Archaea1574Open in IMG/M
Ga0099706_106271Not Available1219Open in IMG/M
Ga0099706_111669Not Available834Open in IMG/M
Ga0099706_113342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. PtaU1.Bin208766Open in IMG/M
Ga0099706_120626Not Available583Open in IMG/M
Ga0099706_123391All Organisms → cellular organisms → Bacteria536Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0099706_101439Ga0099706_1014393F048390MVRFVRTLQHRVTAKGRDFYALSIPPQVAEALGLQAGGQVTIEVRPVKKGKFEIVLKPLSLGDNLNP*
Ga0099706_102550Ga0099706_1025503F054136MIENKAQLLADLAYVGSKVQAKTNVYIFAGAAFMWHGLKDATKDIDICCSYEEADRIVSELRMFGNMESVTGINDVHFLRITFKSFALQIFIKGIWMGDEYPLLEAAHSDSLSFGGITFLIPDVKTLIMIRDRQIQALYNEWKKLQGEKCV*
Ga0099706_102838Ga0099706_1028384F050029VATIIIHWKDKDIPPMELKAAVYKGADSSIINITSNGKDYWFNWSECWYLETYSNE*
Ga0099706_104156Ga0099706_1041561F050777MEDDIIYEKAVEILNPGRLYFALKAMRSSPVKISFDMGDLNLTSGPVSSLISIEGNLPEEVLAMQWLVPLGDLKILQDLIPPDTYYWENRALVLEWQCDLVVDSTIDEKNPLESIEQEEEYRDQLLVSNREYRKLQMALDDCNSHIPQVLFSIYPDRLNFAVNCSQHDEIVGTMIQLRSQNEE*
Ga0099706_106271Ga0099706_1062713F101218MSKRTSKPALPRIKEPPPLPSIDELIAECRAVGWDDLAKSMEKIRYLDSPEGQKALERRERRISRL*
Ga0099706_111669Ga0099706_1116691F090409MKKEFAGILQTSFGMMGSVHFSLEMPGSLIGDANQFLEGARRKRVLVTIETQEVAD*
Ga0099706_113342Ga0099706_1133421F102132CCKRVARRVSIMETQKVVKNLESAINRICKDIKDKKGGSGADKLDSLAKLVNAYSRLIERDREKEKEYDPMEDGDPNYYKKLEANNKDRRGIIR*
Ga0099706_120626Ga0099706_1206262F090409LARGRSNGGDRMKKQFAGTLLTSFGMMGSVHFNLELPGSIIGDTNQFLEGAKGKRVLVTVETEEVMA*
Ga0099706_123391Ga0099706_1233911F102132METQKVVKNLESAINRICKDIKDKKGGSGADKLDSLAKLVNAYSRLIERDRDKEKEIDPMEDGDPTYYKRLEANNKDRRGIIR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.