x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300006232
3300006232: Marine sediment microbial communities, 0.5 km from oil contamination,elevated hydrocarbon, Gulf of Mexico - BC315
Overview
| Basic Information |
| IMG/M Taxon OID | 3300006232 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0116840 | Gp0121736 | Ga0082392 |
| Sample Name | Marine sediment microbial communities, 0.5 km from oil contamination,elevated hydrocarbon, Gulf of Mexico - BC315 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Yale Center for Genome Analysis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 24407073 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota | 1 |
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata | 1 |
| Not Available | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico |
| Location Information |
| Location | Gulf of Mexico |
| Coordinates | Lat. (o) | 28.3 | Long. (o) | -88.2 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
| F001583 | Metagenome / Metatranscriptome | 668 | Y |
| F030135 | Metagenome / Metatranscriptome | 186 | Y |
| F082866 | Metagenome / Metatranscriptome | 113 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
| Ga0082392_120172 | Ga0082392_1201721 | F082866 | MHHQLPNRKRTINLLLRKASGSGKIYVLGQIEPQTPRLVVSFRQYLQVSVLQPYSPQDPKPSGFPRYASEPAYEMVSFKA* |
| Ga0082392_123916 | Ga0082392_1239161 | F001583 | LSYFHIFKKIYLKNYITSESDG*ILGGYAFF*FHYIIALGICLSATHLADLTLTIIANIY*SLFDNIYKTYYVIFTNKHLNTDQMTRIMIFHYFTP*YYLYLIQLHVLFCHES*DSDSGETTFEDKSGSYIS*FYDAFLKEIQDA*Y*TLLVFIYF*SHHASAHTVNFFFFERWNIAELD |
| Ga0082392_135798 | Ga0082392_1357981 | F030135 | SSFTDIGHSTFVGCQFPDAILPGEEAIDLVAGPLN* |