| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006170 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0075597 | Gp0121559 | Ga0082040 |
| Sample Name | Saline water microbial communities from Bras del Port Salterns, Alicante, Spain - SS33 |
| Sequencing Status | Finished |
| Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 35911006 |
| Sequencing Scaffolds | 0 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → saline evaporation pond → saline water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Hypersaline (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Spain: Santa Pola, Valencian Community | |||||||
| Coordinates | Lat. (o) | 55.678 | Long. (o) | -0.555207 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076468 | Metagenome | 118 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0082040_106727 | Ga0082040_1067272 | F076468 | TSDMSQRDIADAVGHPRGTVGIIFRERAPMTKLEEIDTKAVWLSGRYWRREHKVVHIDGDCDQLDACDNPRGPVDPDVLAGDMSVCKRCDPNEPDRYGGTTGTSLAHRLRDGDLQDATLDCDTGGDE* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |