| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005285 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0060822 | Gp0051907 | Ga0065710 |
| Sample Name | Hoatzin crop microbial communities from Cojedes, Venezuela - Epithelial fraction 14 |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 810346924 |
| Sequencing Scaffolds | 0 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Hoatzin Crop Microbial Communities From Cojedes, Venezuela |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Birds → Digestive System → Crop → Lumen → Hoatzin Crop → Hoatzin Crop Microbial Communities From Cojedes, Venezuela |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Cojedes, Venezuela | |||||||
| Coordinates | Lat. (o) | 8.956944 | Long. (o) | -68.299167 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004001 | Metagenome | 457 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0065710_10371187 | Ga0065710_103711871 | F004001 | VVESPSLEVFKKHVDVAIQDRFSRYGGDGLTVGLDDLRGLFQP* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |