


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003966 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0113966 | Gp0109824 | Ga0063591 |
| Sample Name | Enrichment cultures from Harmful Algal Blooms in Lake Erie HABS-00-39862 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Michigan |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 331374827 |
| Sequencing Scaffolds | 0 |
| Novel Protein Genes | 2 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Cephalotes Varians Microbial Communities From The Florida Keys, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Cephalotes Varians → Cephalotes Varians Microbial Communities From The Florida Keys, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → glacial lake → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Lake Fryxell, Antarctica | |||||||
| Coordinates | Lat. (o) | 24.6333167 | Long. (o) | 163.119356 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F058681 | Metagenome | 134 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0063591_101905 | Ga0063591_1019052 | F058681 | MVKGLHTMYLMPNVRAKLPAEAGAVSLVRDDAPCAADQAYGACRSGSA* |
| Ga0063591_102082 | Ga0063591_1020821 | F058681 | VNMLRRSRVRPNVRAKLPAEARSVSLVRDDASMAADQAYA |
| ⦗Top⦘ |