


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003876 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111369 | Gp0096878 | Ga0063039 |
| Sample Name | 373A |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Max Planck Institute for Marine Microbiology |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 143175104 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Black Smoker Hydrothermal Chimney Microbial Communities From Manus Basin, Bismarck Sea |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smoker Hydrothermal Chimney → Black Smoker Hydrothermal Chimney Microbial Communities From Manus Basin, Bismarck Sea |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine black smoker biome → black smoker → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | ||||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029285 | Metagenome / Metatranscriptome | 189 | Y |
| F051533 | Metagenome | 144 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0063039_1005005 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 5194 | Open in IMG/M |
| Ga0063039_1029113 | Not Available | 1432 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0063039_1005005 | Ga0063039_10050053 | F051533 | MEDIKTQPMQEKIIVGTSSLKDLAIYLSGVKDGKGSLQPLGTIVLEDLWNAIKYLQGDVRYTCPERDK* |
| Ga0063039_1029113 | Ga0063039_10291133 | F029285 | MGNLKNKADYSKYKCPYYHLDKECGHKLHGPEGYENTYSVWCPCGFRGPVFYLDPEELNLEKIDVGI* |
| ⦗Top⦘ |