


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003875 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0113941 | Gp0109642 | Ga0063277 |
| Sample Name | Plastic marine debris microbial communities from the Atlantic Ocean - SEA_0063_20120523_metagen |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Marine Biological Laboratory |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 58861724 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia | 1 |
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Plastic Marine Debris Microbial Communities From The Atlantic Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Plastic Marine Debris Microbial Communities From The Atlantic Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → manufactured plastic |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 27.32333 | Long. (o) | -63.565 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007917 | Metagenome / Metatranscriptome | 342 | Y |
| F021307 | Metagenome / Metatranscriptome | 219 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0063277_1075272 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia | 1028 | Open in IMG/M |
| Ga0063277_1142874 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 504 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0063277_1075272 | Ga0063277_10752721 | F007917 | MSKDDIVCLLMILNVNRYANVILERSLRANEGHIGVNESIMTVMKQIWTQMNVYFA* |
| Ga0063277_1142874 | Ga0063277_11428742 | F021307 | MNRILYDNRCRCNEEFSPIKKRQSIGKSEGKSLQYPKSTEVTSKIFQFKYEYNLSSTAKFILNSFQNKYLYYAIDDILYGLKTNLNERDNLLEIL |
| ⦗Top⦘ |