NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003837

3300003837: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_30_12L



Overview

Basic Information
IMG/M Taxon OID3300003837 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0111355 | Gp0109401 | Ga0062498
Sample NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_30_12L
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size3725126
Sequencing Scaffolds5
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas paralcaligenes1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDiffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationMarker 33 diffuse flow vent, Axial Seamount
CoordinatesLat. (o)45.9332Long. (o)-129.982268Alt. (m)N/ADepth (m)1516
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010914Metagenome / Metatranscriptome297Y
F011936Metagenome / Metatranscriptome285Y
F025488Metagenome / Metatranscriptome201N
F042865Metagenome / Metatranscriptome157N
F068773Metagenome / Metatranscriptome124N
F091607Metagenome / Metatranscriptome107N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0062498_101024Not Available542Open in IMG/M
Ga0062498_101587Not Available939Open in IMG/M
Ga0062498_103471Not Available518Open in IMG/M
Ga0062498_103813All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas paralcaligenes788Open in IMG/M
Ga0062498_104347All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales556Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0062498_101024Ga0062498_1010242F010914MIYNILVEQNGKFVTTGETVDCEFEETQAVIDELQLEHGCCYALEAVSE*
Ga0062498_101234Ga0062498_1012342F025488MAYVSRGFIPQTSLASNLGFTRPMYIPAGNGTATALYDIVKVSTSGSTVDTAGVPAGLMGCVRVSDKDHVPCGVIVGFIADPDYLNQTYRSASTARVALVNYDPQVVLEAQEDDNGTTLAVDRIGTPVDLVPGSIDTVTGTSGMQISSATLAGSPGMFRLQQRSFAVDNAAIAGTNTKWLVTFNTHQFKATA*
Ga0062498_101587Ga0062498_1015873F068773MSNELDLNDLGLGDNSRAGVNDKPAGRGAEGRGQSRESRKSLSEHDTARKPERVPMYAQRTMIDTTLIPEGFHGHWVSNNPAGRIDMLLRSGYDFVTKDQNVYSSHVTE
Ga0062498_103471Ga0062498_1034712F042865MSLRVPDYGTFLAADDFNKRIWWSFMQSVVNDLPLNGNVAPENTVRANKSCLYVESTGGTAVLWFNPNGNGSATGWIVK*
Ga0062498_103813Ga0062498_1038131F091607MSLEQQISELNATIKTLNENILLLLGSKEQHSKVECSPVEPVNLCQTEQQTFLPEVAKSDEYTREQLQSLCLEATKRNAANRDIIKAIMLSNFEARKTSDLADNQINLCYSMIAQATKDD
Ga0062498_104347Ga0062498_1043472F011936RDYSRLNDAIVKISESLMALVVIQEQNKSIMQCMEHQSTTIEKLDARIDAIELQMPQLVESRQWLMIGLGLILSMVVVGLIALVIK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.