


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003811 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110170 | Gp0088264 | Ga0007802 |
| Sample Name | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA4M |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 18489198 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → freshwater lake → lake water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Crystal Bog, Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 46.0072 | Long. (o) | -89.6063 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024742 | Metagenome / Metatranscriptome | 204 | Y |
| F088507 | Metagenome / Metatranscriptome | 109 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0007802_103282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0007802_103282 | Ga0007802_1032822 | F088507 | MTNCCNANGECTQGRDCPIRKQRAQEANDAFMNRNNGLEPDLIDDLAASVKGLIALVCVATGVAMIAFAFWGK* |
| Ga0007802_103282 | Ga0007802_1032823 | F024742 | MNNETQRIMEALMLIYGSDLQAATITVLLKDGDTAVRYLSSTFPQKEKQDDTN* |
| ⦗Top⦘ |