Sample 3300003760

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300003760

3300003760: Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2

Overview

Basic Information
IMG/M Taxon OID	3300003760 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0053073 \| Gp0101300 \| Ga0055527
Sample Name	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	86896242
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations
Type	Host-Associated
Taxonomy	Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere

Location Information
Location	USA: North Carolina
Coordinates	Lat. (^o)	35.6667	Long. (^o)	-78.5097	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033107	Metagenome / Metatranscriptome	178	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0055527_1018802	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	733	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0055527_1018802	Ga0055527_10188022	F033107	MKLLNSLALLAIGYLAVTKVNKVHAARFAARPAAKPEEVQTWEGEGGGLPTGGPGPGVKVAPAAVSDPDLAHGGA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.