NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003462

3300003462: Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S13-SC02A



Overview

Basic Information
IMG/M Taxon OID3300003462 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0111425 | Gp0104226 | Ga0059311
Sample NameMarine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S13-SC02A
Sequencing StatusPermanent Draft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size89228001
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geotalea → Geotalea uraniireducens1
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Oscillibacter → Oscillibacter ruminantium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine neritic zone → marine sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationDouglas Channel, British Columbia, Canada
CoordinatesLat. (o)53.6667Long. (o)-129.1333Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008578Metagenome / Metatranscriptome331Y
F040061Metagenome162Y
F054042Metagenome140N
F077198Metagenome / Metatranscriptome117Y
F086604Metagenome / Metatranscriptome110Y
F097559Metagenome / Metatranscriptome104Y
F101182Metagenome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
SC02A_1125603Not Available573Open in IMG/M
SC02A_1208072Not Available521Open in IMG/M
SC02A_1268420Not Available534Open in IMG/M
SC02A_1310983All Organisms → cellular organisms → Bacteria529Open in IMG/M
SC02A_1405213All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geotalea → Geotalea uraniireducens546Open in IMG/M
SC02A_1489647All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon529Open in IMG/M
SC02A_1826988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Oscillibacter → Oscillibacter ruminantium513Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
SC02A_1125603SC02A_11256032F054042MIEDQTPFIQIVYEEIEEYGLYEHKIKLFNLMEAALNGMCGKARKEIDELWWEVQDYKEKLAIPPDESELALHHPTMSV*
SC02A_1208072SC02A_12080721F086604MKYYYGVVHAIVKCEDCPWETESYKNAQATAKIHAKSHGHKVSGELGIGFGYDGRVKSD*
SC02A_1268420SC02A_12684201F008578TRDLENVVAQVNVKFEELFKKIVQLEKQLADNTGEEKNAKGKRPKAS*
SC02A_1310983SC02A_13109831F097559QQFKLAGYDVCVCGSSEFSPMAEDFGVPFEGYPHNYSKLYLENQKTGYIHNIRENIRHQEMLFQGEYDVLSKIAPQFDVMISFLAEMFVPSFAEAFDLPHIKLFTFPMVESDRYAPPTGVPFITENKLLNRLHWRAAAVSAKHLFSYSATVNRLRGELGLPPNRDLLGNNSRCDHM
SC02A_1405213SC02A_14052132F101182MNTYEGDLQYERKMDRISEQIEELMLDAMNAALKKIKDRNLFYSDLQTRPQNDPYPF*
SC02A_1489647SC02A_14896472F077198MSKRKYRIIEEKYEHVSHFYPQYKDENCAYYVLGQDKNGKDITSDYQYFGKFEDCGLVGNRQWKRDVYYSLPMARHYIENDIQVQEHTTEELKETIVHEY*
SC02A_1826988SC02A_18269881F040061TGSIYTQPIWPFITTNSNNKVIKLSIYFSDSTNYMMVSVMEDGKNIYGRYGVTVPKMMHVLVAKAYIWNADPKKYYQVAHKGDDKCNYLPDNLEWKTGSGNHTGKKNKRISSRREDYLFAKSRGFIL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.