


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003254 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111459 | Gp0103159 | Ga0057484 |
| Sample Name | Marine sponge Petrosia ficiformis associated microbial communities from Achziv, Israel - Sample 106 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 58315382 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Sponge Petrosia Ficiformis Associated Microbial Communities From Achziv, Israel |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Sponge Petrosia Ficiformis Associated → Marine Sponge Petrosia Ficiformis Associated Microbial Communities From Achziv, Israel |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Achziv, Israel | |||||||
| Coordinates | Lat. (o) | 33.01 | Long. (o) | 35.04 | Alt. (m) | N/A | Depth (m) | 20 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055778 | Metagenome / Metatranscriptome | 138 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Pfc106_1000033 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 41363 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Pfc106_1000033 | Pfc106_100003321 | F055778 | MLSNVDFPEPELPTIKTISPCSTERVALSRALTLFSPSP* |
| ⦗Top⦘ |