| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002895 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111366 | Gp0096876 | Ga0051972 |
| Sample Name | Midway enrichment cultures of iron-reducing bacteria from Chocolate Pots hot spring, Yellowstone National Park |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Wisconsin, Madison |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 86008788 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Iron-Reducing Enrichment Culture Microbial Communities From Chocolate Pots Hot Spring, Yellowstone National Park, Wyoming, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Iron-Reducing Enrichment Culture → Iron-Reducing Enrichment Culture Microbial Communities From Chocolate Pots Hot Spring, Yellowstone National Park, Wyoming, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → hot spring → spring water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Yellowstone National Park, Wyoming | |||||||
| Coordinates | Lat. (o) | 44.71538 | Long. (o) | -110.73627 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001564 | Metagenome / Metatranscriptome | 670 | Y |
| F069627 | Metagenome / Metatranscriptome | 123 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| MAL_1001472 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| MAL_1004792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3578 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| MAL_1001472 | MAL_10014722 | F001564 | GGLGPKLSAGEWPEQPSLRFLVHWALRREQLCDPGLCPDAPDDGGRCGHCPLDKLDAAQSSEPGLLLRRAIDLRAALKLGVRIDLDEIRADEFRATLTVEEERERLDRERFEDRRP* |
| MAL_1004792 | MAL_10047922 | F069627 | VDLTDEDAVPVYMRISDKVLHLRRLGMTYANIAERLGINPWMPKKAARWAKGQNKQRESFS* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |