


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002894 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0047444 | Gp0096893 | Ga0051973 |
| Sample Name | PDIso1.PF56a |
| Sequencing Status | Permanent Draft |
| Sequencing Center | McGill University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 18576958 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → sphagnum bog → peat soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Tver region, Russia | |||||||
| Coordinates | Lat. (o) | 56.56667 | Long. (o) | 32.76667 | Alt. (m) | N/A | Depth (m) | .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F100207 | Metagenome | 102 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| draft_100347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8949 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| draft_100347 | draft_1003472 | F100207 | VRDPLSEIDSNLLPSREEERLLKRALGSAIPEFIARFGAENAIKRAEAELRRARRARSRKLYAFWSAVLAQIDPGRNESSFRGDRTARSPFAPRQGRQPHEGSARLSDDHLSPAPAGGAARPVITGQALEMPAPNAPRKAASRA* |
| ⦗Top⦘ |