


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002862 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0084162 | Gp0055562 | Ga0004695 |
| Sample Name | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations RNA 2 (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 3552542 |
| Sequencing Scaffolds | 10 |
| Novel Protein Genes | 12 |
| Associated Families | 10 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 7 |
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 1 |
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | polar biome → polar → peat soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Alaska | |||||||
| Coordinates | Lat. (o) | 71.28381 | Long. (o) | -156.5985 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000817 | Metagenome / Metatranscriptome | 879 | Y |
| F037987 | Metagenome / Metatranscriptome | 167 | Y |
| F041277 | Metagenome / Metatranscriptome | 160 | Y |
| F052605 | Metagenome / Metatranscriptome | 142 | Y |
| F065302 | Metagenome / Metatranscriptome | 127 | Y |
| F070134 | Metagenome / Metatranscriptome | 123 | Y |
| F081359 | Metagenome / Metatranscriptome | 114 | Y |
| F100011 | Metagenome / Metatranscriptome | 103 | Y |
| F104110 | Metagenome / Metatranscriptome | 101 | N |
| F105212 | Metagenome / Metatranscriptome | 100 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0004695J43176_100019 | Not Available | 647 | Open in IMG/M |
| Ga0004695J43176_100036 | Not Available | 650 | Open in IMG/M |
| Ga0004695J43176_100220 | Not Available | 821 | Open in IMG/M |
| Ga0004695J43176_100324 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 810 | Open in IMG/M |
| Ga0004695J43176_100325 | Not Available | 583 | Open in IMG/M |
| Ga0004695J43176_100582 | Not Available | 926 | Open in IMG/M |
| Ga0004695J43176_100677 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 809 | Open in IMG/M |
| Ga0004695J43176_100719 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 817 | Open in IMG/M |
| Ga0004695J43176_101869 | Not Available | 597 | Open in IMG/M |
| Ga0004695J43176_104076 | Not Available | 591 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0004695J43176_100019 | Ga0004695J43176_1000191 | F105212 | HKGSPKNGGSGQKFLIELEAKSNGSQDLHHGRVGVQDHKEQSDVIRATKKC* |
| Ga0004695J43176_100036 | Ga0004695J43176_1000361 | F105212 | HKGSPKNGGSGQKFLTEFEAKSYGSQDLHHRWVGVWANREQSNVA* |
| Ga0004695J43176_100220 | Ga0004695J43176_1002201 | F000817 | QKQPAAFNRLKPEVSRIIPGDWGKAGPGWLAKPLLKRIERFGSGGRIHQFL* |
| Ga0004695J43176_100324 | Ga0004695J43176_1003241 | F100011 | MPFIHDCSQTKGQAEPASAYLSPVARDYPNRALRGFFMPTALRL |
| Ga0004695J43176_100325 | Ga0004695J43176_1003252 | F081359 | VCREASIQGKRNWTLGSRTAERSALLDEMLSTVHAGDELGWESGHLE |
| Ga0004695J43176_100582 | Ga0004695J43176_1005822 | F070134 | GVSFLRIPQFLIGVAPSGYRSATSSLHRRSTIQPRLPIDPPTCVGDPISSSAFQLNFRLSSSVRLFGQLSNRSPACAFDPSSCPAFQPIFDLRLRLTFRLRLPTDLRPSPHVDLPTCLPTNLQLAPSANLPAQLSRSRPAFAFCQRSGSAFKPNLRLSSAAVSAWRCPLVCMRPSPLINLPALPANPTSDSHRSLYPFGCLPVYLRLAPPINLPTSPADPTSDSSIAVPLRRCLPAYLRPAPPINLPTQPVDPTSDSSTAVFSGGAFRLIF* |
| Ga0004695J43176_100677 | Ga0004695J43176_1006771 | F052605 | TKWTAESKIEVVRFRIIPGDWGKVELGWLTRLLQTKPQGAAAEAEFTSSSGGVRTPSNANEGLGSKQR* |
| Ga0004695J43176_100677 | Ga0004695J43176_1006774 | F037987 | GMGVRHALFPVPAFGAPFSGAAGFPTPFSTASGVIGLVAGPSGTFQRADFE* |
| Ga0004695J43176_100719 | Ga0004695J43176_1007192 | F041277 | VPDGPATRPVTPLAVENGVGKPAAAEKRAPNAGTGKRAWRTPIP |
| Ga0004695J43176_100914 | Ga0004695J43176_1009141 | F104110 | EDNLSLHAYPSAGKTEGGTMYLGKDVTTEDDMELGKVSDVSISSSGEVYYLVEKGEDPNIRYYFTQEDVLTSNERVVARSVGEFTDDTAKRSHFLCALYGVEVRDATNKRVGVLDNFVASPEGALVVIEDAKGNALVGRYRDLDLTRLSKFAILKQLPAQDSFDEYLKDINRDALLTKGISCDLSSVAKDEGLLSRIRKKLAQSEEDRIITDQALID* |
| Ga0004695J43176_101869 | Ga0004695J43176_1018691 | F065302 | QGSRYDSATRLHADVRFAVRCPGRTVYRSPSPPFSLRQVIAIHRSNHASLTDFSTQPEPESRYGLSLAHNDAYATIARSMFLACTFVSPLKIPANPFDSWLLRSVRFRGRNGAISTPGTRYPHPFPTLPIYPRSPLPFGSFCKDPPDRSVQPVQFQETRLTGRSIVTSLPAASSFDSAAARCAGDPAGNSLRPA* |
| Ga0004695J43176_104076 | Ga0004695J43176_1040761 | F105212 | KGSPKNGGSGQKFLNELEAKSHGSQGPHHRWVGVWDNEEQSEEARITKKC* |
| ⦗Top⦘ |