| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002689 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046785 | Gp0055328 | Ga0005236 |
| Sample Name | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_165m_B (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 37962238 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → coastal inlet → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 48.7299 | Long. (o) | -123.5699 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F034189 | Metagenome / Metatranscriptome | 175 | Y |
| F034764 | Metagenome / Metatranscriptome | 174 | Y |
| F046847 | Metagenome / Metatranscriptome | 150 | N |
| F066454 | Metagenome / Metatranscriptome | 126 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0005236J37288_1004447 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 880 | Open in IMG/M |
| Ga0005236J37288_1008926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3001 | Open in IMG/M |
| Ga0005236J37288_1015541 | Not Available | 553 | Open in IMG/M |
| Ga0005236J37288_1043654 | Not Available | 650 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0005236J37288_1004447 | Ga0005236J37288_10044472 | F066454 | MSIRLDVLILINSGVTDRSEIVERLGINIRSVSNCVRFLIKEGWVEYSREPVSAVGSVGYRITQVGIDKIKASTVDEYRQSPKRKIPDYEVMRSHLGVGDNVSRSELINLWNELTDYYLPYEGDKEFTDVEVFPPCRLLRVMIYVSLSRTTKINTIRSVKG* |
| Ga0005236J37288_1008926 | Ga0005236J37288_10089261 | F034764 | MIQNTSNKPPYVFVPVEYPELAEGEEIQPYQPGFICVEWLELEIIEPSEYN* |
| Ga0005236J37288_1015541 | Ga0005236J37288_10155411 | F046847 | VMPDVDKTVEVETPKTENEVVISQSKLDKLIDKGFSKGANRAKTELADILGVDSIEQARELINAKRETDEANKSDLDKAAELIQTLNSTIDGLESNNKMMVADMAVQKVVTENGIKDADYFKHLLAQASATDDFDQSTFIEQLKGDKPYLFSGGEVQPKKVDATSNRASLDVGERVKSAKTMAE |
| Ga0005236J37288_1043654 | Ga0005236J37288_10436542 | F034189 | MTTNLAKWASNDGQITKSGLPNDRRAKFLPSVVGFAYDLLRYEYYLGNIGL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |