NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002541

3300002541: Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-4-D



Overview

Basic Information
IMG/M Taxon OID3300002541 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0110114 | Gp0061316 | Ga0006567
Sample NameIonic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-4-D
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size126842170
Sequencing Scaffolds4
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria2
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameIonic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa
TypeEngineered
TaxonomyEngineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationJoint BioEnergy Institute, California, USA
CoordinatesLat. (o)38.5402Long. (o)-121.75Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001784Metagenome / Metatranscriptome635Y
F025338Metagenome / Metatranscriptome202Y
F026621Metagenome / Metatranscriptome197Y
F070666Metagenome / Metatranscriptome123Y
F088752Metagenome / Metatranscriptome109N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI25329J36429_1009093All Organisms → cellular organisms → Bacteria2130Open in IMG/M
JGI25329J36429_1026693All Organisms → cellular organisms → Bacteria → Proteobacteria763Open in IMG/M
JGI25329J36429_1036879All Organisms → cellular organisms → Bacteria → Proteobacteria580Open in IMG/M
JGI25329J36429_1042925Not Available511Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI25329J36429_1009093JGI25329J36429_10090932F088752MMKVLQSVYNQITNILKENNVLMNITPPRPYLIKKDDEERINAEAEDLFKKCKIEEYNSKMKEKEAYKLYFDESYKYTNFYEEGDE*
JGI25329J36429_1020266JGI25329J36429_10202662F025338MSVSGADRTRKLLTVGVGTVLIVVMGAVLIAGFRLATQMNANVAALQTASMLQTYPAALAQHLTSLRDRLEARAYAGQALADLRTTVESFDRDLKRLASGPAEGPMQIDQAMMLWRQYAPVLEPVLAFNGQPYIDTDEAGSVLSKEGLEHYADVKRAHLFARENAD
JGI25329J36429_1026693JGI25329J36429_10266931F026621MILRQLQDLIGGIYDVSVAHDVYDFLVTDRGHLPAAARSNPSDEALIVAQDSDSV
JGI25329J36429_1036879JGI25329J36429_10368792F001784MGDVIHVAFGIEREWERAREHAIDGLVTIGALFGDDEALMRAKAECVYQLLRRIVEDMPPLQITTALPDDLSEGQLALVTDALKSAAHKGIQVAMMHSVE
JGI25329J36429_1042925JGI25329J36429_10429251F070666VVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPAFIGSRCRIRGARQYPAKQST*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.