| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002158 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053068 | Gp0059908 | Ga0005855 |
| Sample Name | Freshwater microbial communities from Lake Superior, Canada - Sta WM archaea |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 61815492 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → freshwater lake → lake water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Lake Superior, Canada | |||||||
| Coordinates | Lat. (o) | 47.77199 | Long. (o) | -86.881 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002654 | Metagenome / Metatranscriptome | 539 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI24771J26695_1000823 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1951 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI24771J26695_1000823 | JGI24771J26695_10008232 | F002654 | VCQKGNSPEQVFKVPKFLLSENKEVFKLYNQEIGLEAAIF* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |